NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370516_075995

Scaffold Ga0370516_075995


Overview

Basic Information
Taxon OID3300034696 Open in IMG/M
Scaffold IDGa0370516_075995 Open in IMG/M
Source Dataset NameHot spring water microbial communities from Yellowstone National Park, WY, United States - YNP_Buffalopool_103118
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1124
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Water → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5324Long. (o)-110.7974Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054062Metagenome / Metatranscriptome140N
F102264Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0370516_075995_33_380F054062N/AMGKIRELLWKDFCNGLDKDQPDDVQKEAEHIFFDQLFPEVVLAFFQNASEILLLYEASLIAPAMKPIADAKFNELFKQNPIPFYESLVPVLKNMGAEPEKATFLEICAFLTTYKS
Ga0370516_075995_350_1123F102264N/AMRFLDYLQVVIRLIRPDRNRKGQRILQDFYEYSLARTPDITVAPPPQTPLECLQRLADVRAIHTLIAGAAARLTWKVAKRYNGTEIPDEFRSRNLDRHAGHIVADYLVLGQAFFSENFTYISPLEAFPDTALSIQRPNGTPLQSAFWLMRRLWELNRAETQILSLMGAAAFLYPKDSNMPLTGDELDQLRKNLQDKVRKGGVGGIEPVSVPIELIPIPIDNQKYRLIEIRTQLIRELCNLFQIDSSLLNDPENKTYSN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.