NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370516_174339

Scaffold Ga0370516_174339


Overview

Basic Information
Taxon OID3300034696 Open in IMG/M
Scaffold IDGa0370516_174339 Open in IMG/M
Source Dataset NameHot spring water microbial communities from Yellowstone National Park, WY, United States - YNP_Buffalopool_103118
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)653
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Water → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5324Long. (o)-110.7974Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021808Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
Ga0370516_174339_72_260F021808N/AMVDEKPPYGTIAWYFFEIDERQKQIYELILDIDVKIAKIKELLNEIEMLKAQMEMNINIGKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.