Scaffold Ga0373573_0000665

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0373573_0000665

Scaffold Ga0373573_0000665

Overview

Basic Information
Taxon OID	3300034782 Open in IMG/M
Scaffold ID	Ga0373573_0000665 Open in IMG/M
Source Dataset Name	Sediment microbial communities from coastal wetland in Texas, United States - D0606M02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9746
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Coastal Wetland In Texas, United States

Source Dataset Sampling Location
Location Name	USA: Texas
Coordinates	Lat. (^o)	27.8962	Long. (^o)	-97.0386	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076930	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373573_0000665_6759_7058	F076930	GAG	MAEKPIDELTRRAHHLGFRQGYEIANRTQIDENIPKDAFVDMVLQAVLNSIESTVLKSISDELDLMNEKYPAFDSWKVFADAVIEGAGENFLDRTGNQE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.