NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0373958_0022201

Scaffold Ga0373958_0022201


Overview

Basic Information
Taxon OID3300034819 Open in IMG/M
Scaffold IDGa0373958_0022201 Open in IMG/M
Source Dataset NamePopulus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1184
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil → Populus Rhizosphere Microbial Communities From Soil In West Virginia And Oregon, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia, United States
CoordinatesLat. (o)39.6589Long. (o)-79.9058Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032014Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0373958_0022201_2_145F032014N/AISEKDFTKLYAEYQAALDRPVPAVIHRQDRRIPGCVSAEDSAAWKSR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.