NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0373958_0170417

Scaffold Ga0373958_0170417


Overview

Basic Information
Taxon OID3300034819 Open in IMG/M
Scaffold IDGa0373958_0170417 Open in IMG/M
Source Dataset NamePopulus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)555
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil → Populus Rhizosphere Microbial Communities From Soil In West Virginia And Oregon, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia, United States
CoordinatesLat. (o)39.6589Long. (o)-79.9058Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043380Metagenome / Metatranscriptome156N

Sequences

Protein IDFamilyRBSSequence
Ga0373958_0170417_170_553F043380AGGTGGMAIKGKSKGRSAKAVTPGPKPVYQPVKKPLLAKREFWLVILSILGVVVIGGLVAGFIAERNSSAQDDLEQRMRATMSSFQGQVEPVLATVGQANPPAGYTVFTDLQTAIGQLVAETPGAPADSKALTQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.