NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0325409_059730

Scaffold Ga0325409_059730


Overview

Basic Information
Taxon OID3300034901 Open in IMG/M
Scaffold IDGa0325409_059730 Open in IMG/M
Source Dataset NamePopulus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1943
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)32.1348Long. (o)-81.9657Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002704Metagenome535Y

Sequences

Protein IDFamilyRBSSequence
Ga0325409_059730_1394_1774F002704GAGMDGSEGYNFQSDRWIAIKLLQGFPDALFHGVDEESILVDDEVWSSQAGWTGRKAITFHPTVGSRSNFYRSFRMHFSTELMRNRYSVMMRSGGARLDGRFERPLLSIRPLDRDQTFTGVSGCTFPRS
Ga0325409_059730_870_1130F002704GGAMKLLLEFPDALFHGVDEESILVDDEVWSSQAAWTVLKAITFHPTVGSRSNFYRSFRMHFSMVWVRYRYSMMMRSGRARLDGRFERP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.