NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS021960_Baylor_scaffold_10077

Scaffold SRS021960_Baylor_scaffold_10077


Overview

Basic Information
Taxon OID7000000084 Open in IMG/M
Scaffold IDSRS021960_Baylor_scaffold_10077 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 2, subject 158256496
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)520
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018385Metagenome235Y

Sequences

Protein IDFamilyRBSSequence
SRS021960_Baylor_scaffold_10077__gene_8120F018385N/ASRISGTETMMAEHVNRWDPYKELSIEKDRDPVLDDPIIYGVNVPHFTVTVYSPDGRVNKYWNARILQDQVGNCRIACPRDGKILCFNWFKWTSYMFTHDGMNEVVFMPDSRRRIVSKLSFDHVPMKEVN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.