NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C3964381

Scaffold C3964381


Overview

Basic Information
Taxon OID7000000243 Open in IMG/M
Scaffold IDC3964381 Open in IMG/M
Source Dataset NameHuman stool microbial communities from NIH, USA - visit 1, subject 604812005
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)866
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082715Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
C3964381__gene_148299F082715AGGAGMMKFMKRALSLLISAMLLLGCFALAEEAPLLPIAIVPYDLTDEATTAALSTLIEPKDNALTRWERVVLSDGREAWVICQFDQATMSNAWSRVIDAETQEVLQEDTTDTGFFATAQARWESAKGIYALWSIQDKMLFDRLYAMAPCYGEPVEGDLTQEEALA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.