NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS017511_Baylor_scaffold_33426

Scaffold SRS017511_Baylor_scaffold_33426


Overview

Basic Information
Taxon OID7000000316 Open in IMG/M
Scaffold IDSRS017511_Baylor_scaffold_33426 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 160502038
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20111
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094006Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
SRS017511_Baylor_scaffold_33426__gene_34828F094006AGGMWGALEPAGPTGALHEPAVSMEAHIGELQTGGIARRGLFTFGGSNVLEVAELGAEAPHAIDMYDIALCKPLSELFAEELEYAFNFGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.