NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C1003734

Scaffold C1003734


Overview

Basic Information
Taxon OID7000000619 Open in IMG/M
Scaffold IDC1003734 Open in IMG/M
Source Dataset NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 763759525
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)936
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctSdk10(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027205Metagenome195N
F036281Metagenome170N

Sequences

Protein IDFamilyRBSSequence
C1003734__gene_29104F036281AGGAGMITLIKVDEGPVDIYELRMQYLAKLKETNGVMLPTFIYRNKDLFVTEFKPTCDDQWIMYMTNAEGLITKMRIKNGDLMSNGSVLFLAEERKTYNAKEYYDYWTAREGKPTPFFYESRQYHVKSFMRVPGSTDLWITAERETGHWYTFRMSDDLKSKFTRHAITNEKGH
C1003734__gene_29105F027205N/AKGPRGPSLIERTHVASRLIVSADDILKAVKESEEFEKKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYLLDEYDIPRRIKRSAK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.