Scaffold SRS024435_LANL_scaffold_28092

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SRS024435_LANL_scaffold_28092

Scaffold SRS024435_LANL_scaffold_28092

Overview

Basic Information
Taxon OID	7000000624 Open in IMG/M
Scaffold ID	SRS024435_LANL_scaffold_28092 Open in IMG/M
Source Dataset Name	Human stool microbial communities from NIH, USA - visit 2, subject 159571453
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1913
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemania → Holdemania massiliensis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location Name	National Institutes of Health, USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075480	Metagenome	119	N

Sequences

Protein ID	Family	RBS	Sequence
SRS024435_LANL_scaffold_28092__gene_67829	F075480	N/A	GDTPDSFRQRVAASLPKGEESRHVAFPRRAMVLAAALVLVLTTAYAAVVTHTELVWNAGHPIENEADDRLGLLTGKAGTSGDSLTIGGVTFTVQDGIYSPETGQLFASAVISADESVQLVAVEADMEHEVRLTTPVDAKLDPSGISWAEWAEQNGKTLVPIGMEAAPTLQFLKVNGQTTDTPLIGAFLTQNPDGTVSAGFQVDLTEADTSHLKSCEVQLECRVGAFGKDGKATQWQKEILTATITFK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.