Scaffold SRS016740_Baylor_scaffold_63624

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SRS016740_Baylor_scaffold_63624

Scaffold SRS016740_Baylor_scaffold_63624

Overview

Basic Information
Taxon OID	7000000653 Open in IMG/M
Scaffold ID	SRS016740_Baylor_scaffold_63624 Open in IMG/M
Source Dataset Name	Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160421117
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1178
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location Name	National Institutes of Health, USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103436	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
SRS016740_Baylor_scaffold_63624__gene_77389	F103436	AGGTGG	MITTSKDGWCDKSDAEILNSLKDWVSRCDVKYVKSDALKKIDSAFALWGARQYVEAVHLLEENKVFLEKSDWPYYALGIQILRARKHEFFNE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.