NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2014031004

2014031004: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP9 Dragon Spring, Norris Geyser Basin



Overview

Basic Information
IMG/M Taxon OID2014031004 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0045212 | Gp0051343 | Ga0026372
Sample NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP9 Dragon Spring, Norris Geyser Basin
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size18602353
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Hydrogenobaculum → unclassified Hydrogenobaculum → Hydrogenobaculum sp. Y04AAS11
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CG08_land_8_20_14_0_20_45_121
Not Available4
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springspring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationYellowstone National Park, WY
CoordinatesLat. (o)44.7318889Long. (o)-110.7110833Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039213Metagenome / Metatranscriptome164Y
F041867Metagenome / Metatranscriptome159Y
F059130Metagenome134N
F061391Metagenome132N
F083455Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
YNP9_C2026All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Hydrogenobaculum → unclassified Hydrogenobaculum → Hydrogenobaculum sp. Y04AAS16848Open in IMG/M
YNP9_C2029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CG08_land_8_20_14_0_20_45_121430Open in IMG/M
YNP9_FWOU10506_g1Not Available803Open in IMG/M
YNP9_FWOU15907_b1Not Available781Open in IMG/M
YNP9_FWOU16338_b1Not Available807Open in IMG/M
YNP9_FWOU19993_g1All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon758Open in IMG/M
YNP9_FWOU21297_g1Not Available798Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
YNP9_C2026YNP9_63420F083455MMHMDLFSYQLDISSLWAKDFIVALLGTALAVSLTLANKKGESVFIQLAMIMPVAFAIHALPHINYISLNTIFDDGIIAIGISLVLDYITTKAQRPDLKYRFINAYILLTLYVIIKYQSDVLEFALNSVLITIVFALITYIPPIDDIL
YNP9_C2029YNP9_63530F083455ILGGALAVSLTLANKKGESLPIKFAMILPIASAIHNLEHVNYISFASAFDDIVISAGISLVLDYVTTKAERPDLKYRFINIYVLLTLYAIIKYQTDVFKFMLNSVLMAVVFVLITFLPPIIML
YNP9_FWOU10506_g1YNP9_261520F059130MDQLRVLEKQSGFLRLIYYLGENGEKTITEIMEEADIPVHQLYASIEKALQLKLVKKRVDRSTYPNKNLISLTTKGKKLALKLKEITDLLTFR
YNP9_FWOU15907_b1YNP9_207890F059130MDQLRVLEKQSGFLRLIYYLGENGEKTITEIMEGADIPVHQLYASIEKALQLKLVKRRIDRSTYPNKNLISLTTKGEKLALKLKEITDLLTVQ
YNP9_FWOU16338_b1YNP9_261540F041867MNAFDREFWNGALKASIMIERDLKKLLNEASEGEKEGIKVAIARVREMKESIETLHGNSVMKALREIEIDQK
YNP9_FWOU19993_g1YNP9_237150F039213VRKLVTVSYQYGTITVPQYSRIRINLKSGKVVYGFFVAEINNNFVVIIPNNLALFQKGIVKGSRASIYKGTIRDFKFDKEAIVSYSTNPNNSVTNNGGNVNALH
YNP9_FWOU21297_g1YNP9_206960F061391VSEVIQTPIDITELLTLTGRSRVLTEKVKRCYALVTNPKTFEGVAASLRGYDAASGGWFIPHATHAKQVIQPVIQECVVEPLTMVATGNDAHSLVTLAEFADMLGVDVDVRAVSLQDIIELKLSSCLPQGDGKKPPAYADLVNATSNCLREIVTKALVTLEHVGAAIAFTSRRG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.