 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2014031007 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045212 | Gp0051345 | Ga0026376 |
| Sample Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP11 Octopus Springs |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 28556353 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1 | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → spring water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Yellowstone National Park, WY | |||||||
| Coordinates | Lat. (o) | 44.5340836 | Long. (o) | -110.7978895 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021808 | Metagenome / Metatranscriptome | 217 | Y |
| F080678 | Metagenome | 115 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| YNP11_FWCP12749_g1 | All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1 | 855 | Open in IMG/M |
| YNP11_FWCP14105_g1 | Not Available | 832 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| YNP11_FWCP12749_g1 | YNP11_419180 | F021808 | MMKDEPPYGTIAWFFYEIDEKQRQIYELVFDIDMKIAKIKDLLNEIDILRAQMESNINIRKL |
| YNP11_FWCP14105_g1 | YNP11_380490 | F080678 | MSDVREESGCEDYSNLGGYDDWERIWMGEKEIRRFLAYTGLSAPPYNLRVEHFLKFPFLHGISAGKFMRKLQKLGVTWSFNRDVVRHGVLQAVGYKWRDIEEFEHMRVFGRKEVSTHAGI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |