Basic Information | |
---|---|
IMG/M Taxon OID | 2015219001 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045212 | Gp0051341 | Ga0025763 |
Sample Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP2 Nymph Lake 10 |
Sequencing Status | Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 5509727 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Alphalipothrixvirus → Alphalipothrixvirus SBFV2 | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | aquatic biome → hot spring → spring water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Yellowstone National Park, WY | |||||||
Coordinates | Lat. (o) | 44.7523206 | Long. (o) | -110.7253926 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075084 | Metagenome / Metatranscriptome | 119 | N |
F077502 | Metagenome / Metatranscriptome | 117 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
YNP2_FKNZE9C02PKQS3 | All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Alphalipothrixvirus → Alphalipothrixvirus SBFV2 | 560 | Open in IMG/M |
YNP2_FKNZE9C02QO1AW | Not Available | 517 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
YNP2_FKNZE9C02PKQS3 | YNP252430 | F077502 | MPHHGTDISHIVLWVQQNLPEESNLSSLIDNIFSLINEIILNNLSQGKQPITFTSVREIVDFFKEMIYRSVEQSIGTLTDDVKNQIDTYFFRKLNDIYDKYYS |
YNP2_FKNZE9C02QO1AW | YNP259250 | F075084 | MRPCQKDICLLYSLGADYAKLMDFTRENPAGKLFEAGARAMSYASGLMRLWYGYDTGALLERSLRRILRRSITYCNIMRRLGLESEYCRRFTIYNGVTCDLVSVFTVETAYADILHMITN |
⦗Top⦘ |