NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2022920010

2022920010: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP9 Dragon Spring, Norris Geyser Basin



Overview

Basic Information
IMG/M Taxon OID2022920010 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0045212 | Gp0051343 | Ga0026371
Sample NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP9 Dragon Spring, Norris Geyser Basin
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size13542958
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springspring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationYellowstone National Park, WY
CoordinatesLat. (o)44.7318889Long. (o)-110.7110833Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061391Metagenome132N
F083455Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
YNPsite09_CeleraDRAF_57074Not Available692Open in IMG/M
YNPsite09_CeleraDRAF_scf1119010716205All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae3667Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
YNPsite09_CeleraDRAF_57074YNPsite09_CeleraDRAFT_85230F061391VSEVIQTPIDITELLTLTGRSRVLTEKVKRCYALVTNPKTFEGVAASLRGYDAASGGWFIPHATHAKQVIQPVIQECVVEPLTMVATGNDAHSLVTLAEFADMLGVDVDVRAVSLQDIIELKLSSCLPQGDGKKPPAYADLVNATSNCLREIVTKALVTLEHVGAAIAFTSRR
YNPsite09_CeleraDRAF_scf1119010716205YNPsite09_CeleraDRAFT_188550F083455KLCRRLCMMHMDLFSYQLGISSLWAKDFIVALLGTALAVSLTLANKKGESVFIQLAMIMPVAFAIHALPHINYISLNTIFDDGIIAIGISLVLDYITTKAQRPDLKYRFINAYILLTLYVIIKYQSDVLEFALNSVLITIVFALITYIPPIDDIL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.