Sample 2022920012

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 2022920012

2022920012: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP11 Octopus Springs

Overview

Basic Information
IMG/M Taxon OID	2022920012 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0045212 \| Gp0051345 \| Ga0026375
Sample Name	Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP11 Octopus Springs
Sequencing Status	Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	18442734
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
Type	Environmental
Taxonomy	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.5340836	Long. (^o)	-110.7978895	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080678	Metagenome	115	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
YNPsite11_CeleraDRAF_59540	Not Available	735	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
YNPsite11_CeleraDRAF_59540	YNPsite11_CeleraDRAFT_52560	F080678	KEIRRFLAYTGLSAPPYNLRVEHFLKFPFLHGISAGKFMRKLQKLGVTWSFNRDVVRHGVLQAVGYKWRDIEEFEHMRVFGRKEVSTHAGI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.