Sample 2029527002

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 2029527002

2029527002: Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2-

Overview

Basic Information
IMG/M Taxon OID	2029527002 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0059646 \| Gp0051363 \| Ga0026397
Sample Name	Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2-
Sequencing Status	Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	113475182
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Soil Microbial Communities From Face And Otc Sites In Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	desert biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Nevada Desert Research Center
Coordinates	Lat. (^o)	36.766667	Long. (^o)	-115.95	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023527	Metagenome / Metatranscriptome	209	Y
F104556	Metagenome / Metatranscriptome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
NTS_CREO_AM_FWG71BA01A1UA4	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae	504	Open in IMG/M
NTS_CREO_AM_FWG71BA01CEL13	Not Available	505	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
NTS_CREO_AM_FWG71BA01A1UA4	NTS_CREO_AMB_2209700	F023527	VAALYCSCEQKPQMWGEFWWTGGKYAWIFFDDRETSETYTERITHCPACGQRLERKNLEAVTYPA
NTS_CREO_AM_FWG71BA01CEL13	NTS_CREO_AMB_1322800	F104556	LATLVSSTSAVGGCPILFASPAERSNVSAYDEAEGDALRLLRAIDAEQTHGRVGASVFAFAAARSAGLRPGTERYEEALWRLVCEEALTVDEHIPPEVAAKVPFGRAPYRLAPAAVRMLAKA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.