NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2044078004

2044078004: Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL



Overview

Basic Information
IMG/M Taxon OID2044078004 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0045634 | Gp0051612 | Ga0011096
Sample NameSwitchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size27453735
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_91
All Organisms → cellular organisms → Bacteria1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSwitchgrass, Maize And Miscanthus Rhizosphere Microbial Communities From University Of Illinois Energy Farm, Urbana, Il
TypeHost-Associated
TaxonomyHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere → Switchgrass, Maize And Miscanthus Rhizosphere Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomerhizospheresoil
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationUIUC Energy Farm, Urbana, Illinois 61801
CoordinatesLat. (o)40.109722Long. (o)-88.204167Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005762Metagenome / Metatranscriptome391Y
F067313Metagenome / Metatranscriptome125Y
F074717Metagenome119Y
F083039Metagenome113Y
F085494Metagenome / Metatranscriptome111Y
F103523Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
PVR_F548DK201D7VKVAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9519Open in IMG/M
PVR_F548DK201E4KNPAll Organisms → cellular organisms → Bacteria500Open in IMG/M
PVR_F548DK201ELCT8Not Available501Open in IMG/M
PVR_F548DK202J4Q45All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
PVR_F5IW0KN14IRN0GNot Available517Open in IMG/M
PVR_F5IW0KN15JBX7NAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
PVR_F548DK201D7VKVPVR_723810F085494MSQENVEVVRRATEAWNRRDWITLSALWRSDGVLDWSRARGPFKGVYRGEGER
PVR_F548DK201E4KNPPVR_1290680F083039GRWTPGLDSKHIINQVKPALDGSSNVAVYALDVSTSATPLVFSSNLAANTFGPFIEITNVDFTTEAPPVLAFDPPRNQAILGHDKPSPFIVPPVIGFVDLISGVFIEKTGLGLGVINGIAVDSEDGILCTDTSFDSAVQFTT
PVR_F548DK201ELCT8PVR_914820F103523MAVGLALIGAAVNRLDLFETLGAETFALAAGFALVLLGVIAIAAYAVVRTIEWANRA
PVR_F548DK202J4Q45PVR_609180F005762TGAFIETLMRADGTPLQFDGLWDLLPQAGGVFFTAGIADEEHGLFGLITEDE
PVR_F5IW0KN14IRN0GPVR_1407400F067313KVKKITYIYNVKRRIQELYQTSDDYGIPSMLDLTLTPKQLTYSRK
PVR_F5IW0KN15JBX7NPVR_1626370F074717MTYKRKSVAMYVTQKWYALTGRIVDAKVEADGDIHLALQDANSHNAGTVSAEIPVGPKWCEIRQVVFGWTTQKFPFAVKTAHALKLASRTSS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.