Sample 2070309017

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 2070309017

2070309017: Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 270

Overview

Basic Information
IMG/M Taxon OID	2070309017 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0045401 \| Gp0051419 \| Ga0011141
Sample Name	Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 270
Sequencing Status	Permanent Draft
Sequencing Center	University of Maryland School of Medicine
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	107612854
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	Orebro University Hospital, Sweden
Coordinates	Lat. (^o)	59.274717	Long. (^o)	15.230656	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
umicr_newContig958074	Not Available	1176	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
umicr_newContig958074	mc15a_11404530	F047125	MDVVLLLMVLGVMLSGFWAADALDHIRREILRQEGKRRGW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.