 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2088090031 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063342 | Gp0052015 | Ga0025565 |
| Sample Name | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 120376854 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Brackish Water Microbial Communities From Lake Sakinaw,Canada |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water → Brackish Water Microbial Communities From Lake Sakinaw,Canada |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → lake → brackish water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sakinaw Lake (SAK), BC, Canada | |||||||
| Coordinates | Lat. (o) | 49.682207 | Long. (o) | -124.005217 | Alt. (m) | N/A | Depth (m) | 120 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001055 | Metagenome / Metatranscriptome | 791 | Y |
| F002028 | Metagenome / Metatranscriptome | 602 | Y |
| F035622 | Metagenome / Metatranscriptome | 171 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SaLa_GLZXY3L01B4VV6 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| SaLa_GLZXY3L01CSVQO | Not Available | 566 | Open in IMG/M |
| SaLa_GLZXY3L01DLX4M | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 511 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SaLa_GLZXY3L01B4VV6 | SaLa_00515450 | F002028 | LMFDPNRIRMLTTPYEDSIDQERSEVEAQNKNLLTDTDFPAPNKEQKALYKDYSAEYNNHAVLKNAYRSDFTVAGGKTPPAKTTNDLPMGDKSPMSKIKLPPKPATGNKPRG |
| SaLa_GLZXY3L01CSVQO | SaLa_00428920 | F035622 | MVARKGSCGKKPRVGKVGDPKPSRGGRGLGCGRGRKRK |
| SaLa_GLZXY3L01DLX4M | SaLa_01025810 | F001055 | MGTKSMRHIVEATVATYLSTQTGLTTVTFLTGDSAATQTLPKAVVLCEAARAPSDLPEGEGNFSCSVRITLFSNADDTTLADHRARCAALSGNMRDLVSIKAAFTATGDASCYDVTMQSEDEGIDERSWATSFTFDI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |