Sample 2166559007

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 2166559007

2166559007: Human fecal microbial communities from France, for comparison studies - Human1 (F1-S 0939)

Overview

Basic Information
IMG/M Taxon OID	2166559007 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0047475 \| Gp0052390 \| Ga0010967
Sample Name	Human fecal microbial communities from France, for comparison studies - Human1 (F1-S 0939)
Sequencing Status	Permanent Draft
Sequencing Center	454 Life Sciences
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	10564750
Sequencing Scaffolds	1
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. Marseille-P9312	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	St. Chamond, France
Coordinates	Lat. (^o)	45.460129	Long. (^o)	4.495284	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062845	Metagenome	130	N
F101356	Metagenome	102	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
BAAU01018850	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. Marseille-P9312	538	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
BAAU01015627	Human1-_00155220	F101356	GFGDVGELMPVVTPEKDGLSNSKFATTKIKSEGKRSVLLYRSSSSQWAPFAIRVSCISTGEPSSDFCVYIAGNTMELQDTTKVYVKYLYGQPNSDTYLKMKYESDHRISIYLTSDNSLGDRTIVRELIVRDSMYDMATQDDEITGLADCTIVQ
BAAU01018850	Human1-_00132540	F062845	MKKTPFILHEKFRSENNEQRKERFQKEFERYIIDGLLNAVPSRSCA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.