NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2199352008

2199352008: Thermophilic microbial communities from the Joint Bioenergy Institute, California, USA of rice/straw/compost enrichment - eDNA_2



Overview

Basic Information
IMG/M Taxon OID2199352008 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063773 | Gp0052187 | Ga0026265
Sample NameThermophilic microbial communities from the Joint Bioenergy Institute, California, USA of rice/straw/compost enrichment - eDNA_2
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size256665756
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Bacteria → Proteobacteria2
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameRice-Straw Enriched Compost Microbial Community From Berkeley
TypeEngineered
TaxonomyEngineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationDavis, California, USA
CoordinatesLat. (o)38.5402727Long. (o)-121.7500776Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001417Metagenome / Metatranscriptome699Y
F001564Metagenome / Metatranscriptome670Y
F001784Metagenome / Metatranscriptome635Y
F003125Metagenome / Metatranscriptome506Y
F011110Metagenome / Metatranscriptome295Y
F011252Metagenome / Metatranscriptome293Y
F021612Metagenome / Metatranscriptome218Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
2200087870All Organisms → cellular organisms → Bacteria1539Open in IMG/M
2200089320All Organisms → cellular organisms → Bacteria1482Open in IMG/M
2200140286All Organisms → cellular organisms → Bacteria630Open in IMG/M
2200152320All Organisms → cellular organisms → Bacteria → Proteobacteria20752Open in IMG/M
2200164293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3494Open in IMG/M
2200166197All Organisms → cellular organisms → Bacteria → Proteobacteria19025Open in IMG/M
2200180134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3137Open in IMG/M
2200191210All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales16341Open in IMG/M
2200219843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2527Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
22000878702200312922F001564LCDPRLCPEAPDGGGRCDHCPLDRLDAAQSSETGLLIRRALDLRAALKLGVRVSLDEIRADEFYAMLIFEEERERLDQERINSHGR
22000893202200318360F011110MNEFIWMSPPFGQGEPVQVEAKPEVLIPLMVAGYSQCEPPASREEVKEDVHG
22001402862200444765F001564LCDPALCPDAPEGGRCDHCPLDRLDAAQSSEPGQLLRRALDLRAAFKLGVKLSLDEIAADEFQAMLIVEEEQARFDEERLNRHG
22001523202200469600F001784MGDVIHVAFGIEREWERAREHAIDGLVTIGALFGDDEALMRAKAECVYQLLRRIVEDMPPLQITTALPDDLSEGQLALVTDALKSAAHKGIQVAMMHSVEALMNSIYDLCTSKLQQPEL
22001642932200491406F003125MDPFRILKETWSVGDTIEVEAYRVERQVGLEYDSYRRVYLAHGHEWQIAGQIAKDDGKKYYLLECVA
22001661972200494437F021612MSVSGADRTRKLLTVGVGTVLIVVMGAVLIAGFRLATQMNANVAALQTASMLQTYPAALAQHLTSLRDRLEARAYAGQALADLRTTVESFDRDLKRLASGPAEGPMQI
22001801342200520547F011252VSQYVFVDPGASFALPDSFDFEDYIETERELWALFPETEGKRANFGQVGLTAQIYVEVPDDGSDPGLDETYILMPCPDKTMKPIRMKACRRLTLTEYRMGHLTALKLMGKMNAAARVMQEVGRQILGEEVMEEVRARMQPKEEDDDENGNE
22001912102200538705F001417VQDAVTQMTFSSCDKDDVLELIERVENELHSPHPNLALMCTFLNSIARSLRAQPEAREACLAIEEAIEKAGMPSTWQSGI
22002198432200585456F003125MDPFRILKQTWSVGDTIEVEAYRVERQVGLEYDSYRCVYLAHGHEWQIAGQIAKDDGKKYYLLECVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.