Basic Information | |
---|---|
IMG/M Taxon OID | 3300000060 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046786 | Gp0051899 | Ga0026009 |
Sample Name | Panchlora_midgut_metagenome |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 765263861 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Panchlora Sp. Gut Microbial Communities From Gamboa, Panama |
Type | Host-Associated |
Taxonomy | Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Panchlora Sp. Gut → Panchlora Sp. Gut Microbial Communities From Gamboa, Panama |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Panama | |||||||
Coordinates | Lat. (o) | 9.116667 | Long. (o) | -79.7 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014156 | Metagenome | 265 | Y |
F030633 | Metagenome | 184 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
PaMGMunAill_c0118007 | Not Available | 672 | Open in IMG/M |
PaMGMunAill_c0213924 | Not Available | 561 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
PaMGMunAill_c0118007 | PaMGMunAill_01180072 | F030633 | NSRDKYHSERGFLGMFPIMVAPLGEVCGVPRRLL* |
PaMGMunAill_c0213924 | PaMGMunAill_02139241 | F014156 | MMVTRSLLDDTVIKQLKWYGHVERMGEKRLSTKQAVTWCSTIKK* |
⦗Top⦘ |