 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000208 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053053 | Gp0053411 | Ga0026123 |
| Sample Name | Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_AFX |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 177830987 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca |
| Type | Engineered |
| Taxonomy | Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Newby Island compost facility, Milpitas, CA | |||||||
| Coordinates | Lat. (o) | 37.454581 | Long. (o) | -121.928712 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004253 | Metagenome | 446 | Y |
| F028447 | Metagenome / Metatranscriptome | 191 | Y |
| F036417 | Metagenome / Metatranscriptome | 170 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| NICFPass4AFXDRAFT_c001079 | All Organisms → cellular organisms → Bacteria | 18793 | Open in IMG/M |
| NICFPass4AFXDRAFT_c009255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3606 | Open in IMG/M |
| NICFPass4AFXDRAFT_c024934 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| NICFPass4AFXDRAFT_c001079 | NICFPass4AFXDRAFT_00107918 | F036417 | LPRRRGFAICFRAMVYPARVPLRTRIPTVLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR |
| NICFPass4AFXDRAFT_c009255 | NICFPass4AFXDRAFT_0092555 | F004253 | MRSALRQPPNKQLQRTVIPNHGRAASAPPHYALAARGIRGRAAAELRR |
| NICFPass4AFXDRAFT_c024934 | NICFPass4AFXDRAFT_0249341 | F028447 | DGSGWAEVDWVSAVRGSRYYYRHAEPHDEALAMLPPFYRVVTRLDTPDLHAPHENSYYVPRERLADFLLEIALAGGAETIWHVEPCPDPPPESRVRQITGTP |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |