NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000233

3300000233: Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10



Overview

Basic Information
IMG/M Taxon OID3300000233 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063446 | Gp0053571 | Ga0026095
Sample NameGroundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size242610534
Sequencing Scaffolds11
Novel Protein Genes11
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGroundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomeaquiferbiofilm material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationFissure Spring, Frasassi Caves, Italy
CoordinatesLat. (o)43.383333Long. (o)12.95Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002525Metagenome / Metatranscriptome552Y
F015419Metagenome / Metatranscriptome255Y
F044511Metagenome / Metatranscriptome154Y
F059119Metagenome / Metatranscriptome134Y
F084884Metagenome / Metatranscriptome112Y
F096680Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
TB_FS06_10DRAFT_1003307All Organisms → cellular organisms → Bacteria7461Open in IMG/M
TB_FS06_10DRAFT_1005965All Organisms → cellular organisms → Bacteria5217Open in IMG/M
TB_FS06_10DRAFT_1007459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4494Open in IMG/M
TB_FS06_10DRAFT_1011286All Organisms → cellular organisms → Bacteria3368Open in IMG/M
TB_FS06_10DRAFT_1015936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium2597Open in IMG/M
TB_FS06_10DRAFT_1017362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2435Open in IMG/M
TB_FS06_10DRAFT_1042999Not Available1104Open in IMG/M
TB_FS06_10DRAFT_1043827All Organisms → cellular organisms → Bacteria → Proteobacteria1084Open in IMG/M
TB_FS06_10DRAFT_1043859All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium1084Open in IMG/M
TB_FS06_10DRAFT_1045592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium1043Open in IMG/M
TB_FS06_10DRAFT_1050117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi954Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
TB_FS06_10DRAFT_1003307TB_FS06_10DRAFT_100330714F084884MHPTLGSLARFQAFFYASAFFQSDGVPPPDPARVTQTVGRLNT*
TB_FS06_10DRAFT_1005965TB_FS06_10DRAFT_10059657F084884QSVHPTLGILARFQAFFYALSFSQSDGVPPPAPARVTQTVGTPLA*
TB_FS06_10DRAFT_1007459TB_FS06_10DRAFT_10074599F002525VWAGVDSLWEQEKLEARKMLENAAESHTSGARFVGQPAGLPEP*
TB_FS06_10DRAFT_1011286TB_FS06_10DRAFT_10112863F044511MAKNGLTKRAPDAGDSGVIPSIFLRLIIFPVGRRPAARPSAGNANR*
TB_FS06_10DRAFT_1015936TB_FS06_10DRAFT_10159362F015419MEYKVQITDEAGNIQQYVVSRSSSFEHKSLNDFILEALRISEDKRKLPLKTQCPNGLEVYPSIKMKFENYGCAILGDKLEAMHITWRE*
TB_FS06_10DRAFT_1017362TB_FS06_10DRAFT_10173623F096680MQTILPSVIFLSIVIVFGVDANRKRRDFLKKRNRA*
TB_FS06_10DRAFT_1042999TB_FS06_10DRAFT_10429993F059119MLELIILALTAQLLFSFFGQTIFPRVPHTGGFIYMLSIAIVSLIILKFLMWS*
TB_FS06_10DRAFT_1043827TB_FS06_10DRAFT_10438271F002525VWAGVDNAWEQEKPEARKMPVNRAESHTSGARFVGWLCARRAD*
TB_FS06_10DRAFT_1043859TB_FS06_10DRAFT_10438591F084884QSVHPTLGILARFQAFFYASAFFQSDGVPPPAPAQVTQTVGRFRAKHTK*
TB_FS06_10DRAFT_1045592TB_FS06_10DRAFT_10455921F002525CVWAGVDNAWEQEKLEARKMLLKRAESHTSGARFVGQPLR*
TB_FS06_10DRAFT_1050117TB_FS06_10DRAFT_10501172F002525VWAGVDSAWEQKKLKARKMLVNRADSHTSGARFVGQFLFISYLFS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.