 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000276 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045762 | Gp0054115 | Ga0010838 |
| Sample Name | Human fecal microbial communities from Cork, Ireland - EM166 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI), Macrogen |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 55372890 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Cork, Ireland | |||||||
| Coordinates | Lat. (o) | 51.907 | Long. (o) | -8.472 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084124 | Metagenome | 112 | Y |
| F099451 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| EM166_1000374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides | 50754 | Open in IMG/M |
| EM166_1001319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 34717 | Open in IMG/M |
| EM166_1006308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 97997 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| EM166_1000374 | EM166_100037464 | F099451 | MRIDKIKTVGQLRKVIENLSDDYEIEMRIRRKLTDEDIIKLHKKYGKIYPYPYETSYSELEFDDVGVSDKVLCLGVELKE* |
| EM166_1001319 | EM166_100131912 | F084124 | LLFGGLNATAKAFARATKGNKHHFHSQRNALTMFLAFLFIMAVACFNKLSFSTQTAWLFEPDKLLYRKILWALPKPAIFEKIE* |
| EM166_1006308 | EM166_100630817 | F084124 | LLFGGLNKQAKAFARATKGNKHHFHSQRNALTMFLAFLFIMAVACFNILSFSTQTAWLFVPKKLLYRKILWALPKPAIF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |