Sample 3300000283

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000283

3300000283: Human fecal microbial communities from Cork, Ireland - EM238

Overview

Basic Information
IMG/M Taxon OID	3300000283 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0045762 \| Gp0054280 \| Ga0010840
Sample Name	Human fecal microbial communities from Cork, Ireland - EM238
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Genomics Institute (BGI), Macrogen
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	40876228
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	Cork, Ireland
Coordinates	Lat. (^o)	51.907	Long. (^o)	-8.472	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081354	Metagenome	114	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
EM238_1003286	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium	2451	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
EM238_1003286	EM238_10032861	F081354	LVRENQQSSAHNFVKDFSSFFPESRRRSPLKKGAVATIPLEYGKAEVQILFEPLQATISSMELPKNFENKKLPNTLR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.