x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300000478
3300000478: Deep mine microbial communities from Beatrix mine, South Africa, that are thermophilic, sample 2
Overview
Basic Information
IMG/M Taxon OID 3300000478 Open in IMG/M
GOLD Reference (Study | Sequencing Project | Analysis Project) Gs0070940 | Gp0054547 | Ga0011558
Sample Name Deep mine microbial communities from Beatrix mine, South Africa, that are thermophilic, sample 2
Sequencing Status Permanent Draft
Sequencing Center Inqaba Biotechnologies
Published? N
Use Policy Open
Dataset Contents
Total Genome Size 1876407
Sequencing Scaffolds 2
Novel Protein Genes 2
Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage 1
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Deep Mine Microbial Communities From Beatrix Mine, South Africa, That Are Thermophilic
Type Environmental
Taxonomy Environmental → Terrestrial → Soil → Unclassified → Mine → Deep Mine → Deep Mine Microbial Communities From Beatrix Mine, South Africa, That Are Thermophilic
Alternative Ecosystem Assignments
Environment Ontology (ENVO) terrestrial biome → mine → soil
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
Location Information
Location Beatrix mine, Free State, South Africa
Coordinates Lat. (o ) -28.3 Long. (o ) 26.75 Alt. (m) N/A Depth (m) N/A
Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F015419 Metagenome / Metatranscriptome 255 Y F042051 Metagenome / Metatranscriptome 159 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link BPH_10975 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage 759 Open in IMG/M BPH_13047 All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium 1767 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
BPH_10975 BPH_109751 F042051 MTTFGEVNWNDDVFGGNEGKKNTNGKDLFLRLKEGSNEMRLVTQPFQYLVHKYKKEGDSGFGQKVHCSAIHGSCPLCETGDKAKPRWLLGVISRESGTYKILDISFAVFSQIRKLAKNTQRWGDPTKYDIDIVVDKNGGATGYYSVQPISKEPLSAADQKIKDNVDLDDLKRRVTPPTADLVQKRIDKINGVGDANAAAPAKGKPATKAPAKAAAPAVSMTDDEEMDESFPAY BPH_13047 BPH_130473 F015419 MEYKVQITDEAGNIRQYNVSRSSSSEDKSLNDFILEALQISEDKRKLPLKIQCPNGLEVYPSIKMKFENYGSPLLGDKLEAMHITWRDGL*