NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000668

3300000668: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19



Overview

Basic Information
IMG/M Taxon OID3300000668 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0075432 | Gp0054713 | Ga0001942
Sample NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3725998
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
Not Available1
All Organisms → cellular organisms → Bacteria → Acidobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameTropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → tropical forest → forest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)N/ADepth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005929Metagenome / Metatranscriptome386Y
F011941Metagenome / Metatranscriptome285Y
F016424Metagenome / Metatranscriptome247Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12413J11882_100667All Organisms → cellular organisms → Bacteria611Open in IMG/M
JGI12413J11882_101033Not Available519Open in IMG/M
JGI12413J11882_101138All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12413J11882_100667JGI12413J11882_1006671F011941MAEPRQNRGPFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVGVKEFDDEDGGNLRKSVVRAATRGEHD
JGI12413J11882_101033JGI12413J11882_1010332F005929MRENXSLLSFWGLVFSLIAVTLFVVIYSYQKSKYANRNIVGDLRQRSVDVYLAAKTPEAESDSKKFREASNEIERLRAETRVLFWLIIAMNTAVIIIFILAYRYF*
JGI12413J11882_101138JGI12413J11882_1011381F016424VAKSGNKLPRKSVRDEKSEFGKDRRRRHHHYLVTVNYADGETFGRVYTDKDKATRFADRQRRSPIVKSARVTQVS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.