Sample 3300001012

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001012

3300001012: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY76

Overview

Basic Information
IMG/M Taxon OID	3300001012 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0085351 \| Gp0057687 \| Ga0011723
Sample Name	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY76
Sequencing Status	Permanent Draft
Sequencing Center	J. Craig Venter Institute (JCVI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	747106004
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Macroalgal Surface Microbial Communities
Type	Host-Associated
Taxonomy	Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Botany Bay, Sydney, NSW, Australia
Coordinates	Lat. (^o)	-33.966629	Long. (^o)	151.166614	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035316	Metagenome / Metatranscriptome	172	Y
F058153	Metagenome	135	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
BBAY76_10049280	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	837	Open in IMG/M
BBAY76_10064074	Not Available	732	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
BBAY76_10049280	BBAY76_100492803	F058153	TDPDIRRDIMLDVEQISQELAPTAMHQVGGELEWIDLVFNDAADPQLVVETTRAMLWNYSEVMIRGLIEDEAAKHADEMDIKPETALDLGVRDSDF*
BBAY76_10064074	BBAY76_100640742	F035316	RGDFSAVSNFTAKWGGYNSIFGLSNGDITKFEHITKLGVHECLTYLTYTKEKNEIEARQIKSKFK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.