Sample 3300001217

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001217

3300001217: Switchgrass Microbiome

Overview

Basic Information
IMG/M Taxon OID	3300001217 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0087828 \| Gp0055911 \| Ga0012414
Sample Name	Switchgrass Microbiome
Sequencing Status	Permanent Draft
Sequencing Center	Oak Ridge National Laboratory
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	82153491
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere

Location Information
Location
Coordinates	Lat. (^o)	55.678	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007280	Metagenome / Metatranscriptome	354	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
J438_102087	J438_1020871	F007280	AIAVAAVLPGKLDNIGGETLLVVTTARDLALRRAMLPERRTGATLGDMQLRSDLLNAGTATRGA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.