Basic Information | |
---|---|
IMG/M Taxon OID | 3300001217 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0087828 | Gp0055911 | Ga0012414 |
Sample Name | Switchgrass Microbiome |
Sequencing Status | Permanent Draft |
Sequencing Center | Oak Ridge National Laboratory |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 82153491 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | ||||||||
Coordinates | Lat. (o) | 55.678 | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007280 | Metagenome / Metatranscriptome | 354 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
J438_102087 | J438_1020871 | F007280 | AIAVAAVLPGKLDNIGGETLLVVTTARDLALRRAMLPERRTGATLGDMQLRSDLLNAGTATRGA* |
⦗Top⦘ |