NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001321

3300001321: Bioengineered switchgrass rhizosphere microbial community from Knoxville, Tennessee, USA - 15 Joint



Overview

Basic Information
IMG/M Taxon OID3300001321 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0090446 | Gp0059788 | Ga0012385
Sample NameBioengineered switchgrass rhizosphere microbial community from Knoxville, Tennessee, USA - 15 Joint
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17265362
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBioengineered Switchgrass Rhizosphere Microbial Community From Knoxville, Tennessee, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Bioengineered Switchgrass Rhizosphere Microbial Community From Knoxville, Tennessee, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationKnoxville, Tennessee, USA
CoordinatesLat. (o)35.98Long. (o)-83.92Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000573Metagenome / Metatranscriptome1016Y
F001790Metagenome / Metatranscriptome633Y
F013354Metagenome272Y
F028907Metagenome / Metatranscriptome190Y
F030963Metagenome / Metatranscriptome183Y
F049869Metagenome146N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Microbial15j_103070All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
Microbial15j_105141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria641Open in IMG/M
Microbial15j_109670All Organisms → cellular organisms → Bacteria760Open in IMG/M
Microbial15j_121021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum537Open in IMG/M
Microbial15j_134876All Organisms → cellular organisms → Bacteria615Open in IMG/M
Microbial15j_140591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium511Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Microbial15j_103070Microbial15j_1030701F013354FRELAKKAEGARLDEIRQTVARLQTDNEKIDLLIQIAGDTQKTNEKLAVQVLDEARQIVNHRATNYQQFEQQLKVAHAFADVDAARAFEVLEPGIGQLNELLQAASTLSGFEINMFRDGEMAIQGGNGLTATVNRYGQELAVLAKNDFERAETLTGRFQFTEPRIMTRLAIVQGLLNAKPVSGGTRIITGGFSETVVTRP*
Microbial15j_105141Microbial15j_1051411F000573RLVVSIGIGGAAYAIMLGIMVLSIVYDRELEPVVTFAFDTGRGIIGAIDSLVSGSHWGQVAANHLRERVNMTHVVLSIPAIIIAAIVIGIPFNYLLGGTRTALQRIAIALISVPATVGLAVGLFTFNALLPEAYAVLLRFADLVWHASWNALSSSGDWLPGARKLTNAARQGFSGHHYVIMALCSMAASFLVNALFAFVSRPAPAGIAQPRCD
Microbial15j_109670Microbial15j_1096702F028907FNVEIGTALLRFNEEAVLYCRGISDAAAHEYAMDYARMLRSRAKGLEFERTHFSGHLLEPDRNLIEGTLDRMYRKYFGTYRVASKLL*
Microbial15j_121021Microbial15j_1210211F030963LGEAGTGFLIIRLVITFLFLVKTRGATLAGVCLHLEAD*
Microbial15j_134876Microbial15j_1348762F001790VPPLRFAGCSMPSYDRALWALRTWLDSWPGIGHVAVGMHRQGYDLQL
Microbial15j_140591Microbial15j_1405911F049869SFTCQFASTTARDIPVALPVFLNHFDPDTGTLIISSPAVMKRVENVRQRPKVAILFSPVGTEPGEPKHVLLVQGLAEVDDTNLMSGWKRYFAGWARRQPSARESLARMEQVVPGYTQRALIRVRPTRFLGWPDGNFQQSPEVVEVNQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.