NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001329

3300001329: Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-5cm)- 6 month illumina



Overview

Basic Information
IMG/M Taxon OID3300001329 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0083722 | Gp0054896 | Ga0011036
Sample NamePermafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-5cm)- 6 month illumina
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Tennessee
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size31976169
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1
All Organisms → cellular organisms → Bacteria1
Not Available1
All Organisms → cellular organisms → Bacteria → Acidobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePermafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → active permafrost layer → permafrost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationAxel Heiberg Island, Nunavut, Canada
CoordinatesLat. (o)79.26Long. (o)-90.46Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002094Metagenome / Metatranscriptome594Y
F016071Metagenome / Metatranscriptome250Y
F025332Metagenome / Metatranscriptome202Y
F084617Metagenome / Metatranscriptome112N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
A285W6_1040332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium561Open in IMG/M
A285W6_1040800All Organisms → cellular organisms → Bacteria660Open in IMG/M
A285W6_1044410Not Available556Open in IMG/M
A285W6_1091297All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
A285W6_1040332A285W6_10403322F016071MPHQIERKFAFGPSALDDLARAFDSAWKELSAQGVEMNSEEQLRCIRTKLAQRIMEYATEGEHGVGHLKEFGLQGLPHL
A285W6_1040800A285W6_10408002F084617VAVIEPGDASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVAVIVVILYLLGR*
A285W6_1044410A285W6_10444102F025332MIRELAFASKQGMTAETLLWRGVIAVTIQDWLSKPLRPKREAERYLFENSADLSLVCSSAGIDVGQLRERLNKVRGRTLLDLLPVAA*
A285W6_1091297A285W6_10912971F002094PTGDLGTVERSNEEDAVVKWDDDGRMRLRQRSLKKI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.