NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001422

3300001422: Oil sands microbial communities from Horse River, Alberta, Canada - outcrops



Overview

Basic Information
IMG/M Taxon OID3300001422 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0047444 | Gp0055927 | Ga0012417
Sample NameOil sands microbial communities from Horse River, Alberta, Canada - outcrops
Sequencing StatusPermanent Draft
Sequencing CenterMcGill University
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size23719607
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium parascrofulaceum1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHydrocarbon Resource Environments Microbial Communities From Canada And Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Sand → Oil-Contaminated → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → outcrop → sand
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationHorse River, Fort McMurray, Alberta, Canada
CoordinatesLat. (o)56.70268Long. (o)-111.398858Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009302Metagenome / Metatranscriptome320Y
F017704Metagenome / Metatranscriptome239Y
F025881Metagenome / Metatranscriptome200Y
F044211Metagenome / Metatranscriptome155Y
F066257Metagenome / Metatranscriptome127Y
F087928Metagenome / Metatranscriptome110Y
F102104Metagenome / Metatranscriptome102Y
F103709Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Draft_100086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium13892Open in IMG/M
Draft_100252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium parascrofulaceum8736Open in IMG/M
Draft_100643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae5218Open in IMG/M
Draft_100759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium4791Open in IMG/M
Draft_102489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2334Open in IMG/M
Draft_103522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1925Open in IMG/M
Draft_104519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1656Open in IMG/M
Draft_107125All Organisms → cellular organisms → Bacteria1167Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Draft_100086Draft_10008614F066257MTYPAVDNLPEEATSTLLGVCAQLSRSRHPGLARWASSVSDALLVRLVSVTTGVRVDGNGNKPCPLKTLAAAELEGLHALLFAGAEASDDEWVVDWCTRMNGLILADFCRRELEQLAIDAQANAILAEERRLACLALQAPDLRVVSRRSAV*
Draft_100252Draft_1002526F087928VPSTSHLAELEVESTDVVTAWSALEPVVAWCAETLGLPATKSDYHVGHPDDQGTVAGAGLSDCLDRVESPTSISVTYTMSSDSGGDPRSVELRIMRYRRFKELNVHLRVDGPANADVGLFRAHPEDGRTGD*
Draft_100643Draft_1006432F044211MTHLSDGTVATDIDAHGDNAALSAHGYTIRHIETYHRDTDMSCIVWDAPAITEADLPF*
Draft_100759Draft_1007591F009302VRMTTAPQTVEPTWVCDECAGEGQLAYDPEATMWVPRSATADWPADDSIAISVLDCLQCDGTGTMRLDPADGNRPTRSAR*
Draft_102489Draft_1024891F017704MAVRAQRALMGNHCLVLWEVWLVSPLEMCGQEVSRVRAHRRVSRTSPPWSSVRPEGRDHLVGGSPTRAMVGWPGSWQAVRSGNWPCRSPATNLALGGGANRRAVTCVKPEQASKGKLWTPTRPKIGEGSTVWGSSRQTHLERSTGVRGTARRDRGSRKRGRSVRDGGSGLNDAEGHWSARKSDRVVVPPKPGNSGGGKDPDFWYVFEANEVR*
Draft_103522Draft_1035223F103709VEWGSNRQMHPFWSIGVVGTACQKGEPGNWGRPVVGEGSGLDVVAERRLWRVSDRVIVLLRLGNASGGKDPDFWCAFEGVEDW*
Draft_104519Draft_1045192F102104MKNMILAAFAALTLGVAIAPVANAASFGSSVAGDSQATQMQRTGSYSR*
Draft_107125Draft_1071251F025881MATAPSVIEVTAGEIAAELKRRGISSDERVTLTIEPERELIPGRRESRTKVVAAGLSDADIDRLIKQAQHEVEPRIA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.