NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001627

3300001627: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024



Overview

Basic Information
IMG/M Taxon OID3300001627 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085736 | Gp0057305 | Ga0003863
Sample NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3602557
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Acidobacteria1
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomesolid layerforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.471116Long. (o)-72.17263Alt. (m)N/ADepth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003124Metagenome / Metatranscriptome506Y
F009027Metagenome / Metatranscriptome324N
F038357Metagenome / Metatranscriptome166Y
F051575Metagenome144Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20258J16339_100121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1344Open in IMG/M
JGI20258J16339_100339All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M
JGI20258J16339_100490All Organisms → cellular organisms → Bacteria699Open in IMG/M
JGI20258J16339_100577All Organisms → cellular organisms → Bacteria638Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20258J16339_100121JGI20258J16339_1001211F038357MCPGDPLGNHRQRPIAVSLVFEPVLAHEDGMGLTAPLPHQGRAGLQRSAGVERTSAFLELSRQNLQAALQGGGRAAMGTLLQLIGETPDDQIATEAQRRADVMQSPPRTPQLLCRLTDQLSDFAINLCQCQTSQPVLPAAVCTERLARVLASRSVVEWGFHGLAGSAMRYTRPRSSLAEARGSPSFFFKVPEKTPRTV*
JGI20258J16339_100339JGI20258J16339_1003392F003124MVYNVYMATTKQARRSVTLPPQVDRQIDTIAKNRRLSGNRVLVELVELGLEARKQKEKAFFELAKKFRDADDPQEVKQLGDELGRFVFGE*
JGI20258J16339_100490JGI20258J16339_1004902F009027DAIIAERQLPRIRVIDAVHPLFGQPLEVSPSGLIRRIGWIRVVLPDGRHRWVPQKATDLNVSACEARPNRDLPLVSVRTLIPLAEYVRARLSALGERFDETSGHTADPAVRAGIAGSTADLGAEIVADDDADNTTTAGEAGGTATPVNAGRSRRRRFDRGASR*
JGI20258J16339_100577JGI20258J16339_1005772F051575MRIGGEAPGGGPILSVGLKCQVEYGFPPPRIVNSAVVRKASASAEWC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.