NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001988

3300001988: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP4 Joseph's Coat Springs



Overview

Basic Information
IMG/M Taxon OID3300001988 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0045212 | Gp0051338 | Ga0026354
Sample NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP4 Joseph's Coat Springs
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size14539159
Sequencing Scaffolds3
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.1
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 11
All Organisms → Viruses → Predicted Viral1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationYellowstone National Park, WY
CoordinatesLat. (o)44.733519Long. (o)-110.333Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038745Metagenome / Metatranscriptome165Y
F051572Metagenome / Metatranscriptome144N
F062912Metagenome / Metatranscriptome130Y
F077497Metagenome / Metatranscriptome117Y
F080679Metagenome115Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JC3A454_101264All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.1531Open in IMG/M
JC3A454_102074All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 12089Open in IMG/M
JC3A454_103426All Organisms → Viruses → Predicted Viral1145Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JC3A454_101264JC3A454_1012642F051572MGRGPFADVRTFADVVLEGGCKKSLQFLKARLDLCVLAALVKAVPAGSMVKLRPGLVWRLAEELAAAAGRDRERVRNALLKRAGEVMARLRRELGDKAPAEALLARLAELFLEELEA*
JC3A454_101264JC3A454_1012643F038745MDRAAVACGELMQVSLALSAYYPLCSGGPPCAFAESVERLVRRAASARGAEELVEVMGGRIRLEGLGLPAPALEALAEGLGPEPRWLDALAASFFRLYLGLHKRRRVDGRDLALALCLWAQKRRREDPGNPLWRAAELEPDRLYTEEEAREALGVEEALFRRLWRRALAFHRGEKAYGFQLILAALSLMAAPPRSV*
JC3A454_102074JC3A454_1020744F062912MMNPMEILEKTYNLFLISEIIESESDLDKELERLLVDRDYNTMAKTLLYVLIYTLNNDTTYKNIRNIYINEAIDLLYMIDRIEFDDERIMKKFIQLIYRFISYSLEYKIKFITDHEKRELVKAKLHELVNII*
JC3A454_102074JC3A454_1020747F077497MDQEQINKIERIIEKYLFETMNNTDYELRKMDVIIKYLIYQKLKDIDETLKSIDENLFISANSDIYEK*
JC3A454_103426JC3A454_1034261F080679MDEDAISRLLSKKSLRIIRYLYNNDYATLRTLEKALRMNGVTAREYIDLLSKYGIVKVSRVGRAYVIMLNREGKYTKAIIEFLKQVGYL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.