NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002093

3300002093: Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection C1



Overview

Basic Information
IMG/M Taxon OID3300002093 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053054 | Gp0055685 | Ga0005087
Sample NameSoil microbial communities from Rifle, Colorado - Rifle Oxygen_injection C1
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size129080705
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pseudomonas phage phiK7A11

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Rifle, Colorado, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → land → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationRifle, Colorado, United States
CoordinatesLat. (o)39.534762Long. (o)-107.782602Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071896Metagenome / Metatranscriptome121N
F091594Metagenome / Metatranscriptome107Y
F094884Metagenome / Metatranscriptome105Y
F100657Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C687J26627_1000189All Organisms → cellular organisms → Bacteria27578Open in IMG/M
C687J26627_1000583Not Available11085Open in IMG/M
C687J26627_1005424All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2534Open in IMG/M
C687J26627_1033053All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pseudomonas phage phiK7A1706Open in IMG/M
C687J26627_1036776Not Available655Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C687J26627_1000189C687J26627_100018971F100657MTQITISYTTSVFTPAGWRNETVTATVEVISPKRGRVLCVQDIGGNGNSGYGSRTGAKRQAYHVGGIAMREQGKIKNLSACCIL*
C687J26627_1000583C687J26627_10005836F094884MPKDKLIGTAYVNIIKDEKGQVKFAYGYELDDNAVSLNDLGMLNSFLGKLKNKAQEDFNERLDINDKEFSIEKDGVEEDEGN*
C687J26627_1005424C687J26627_10054244F091594MSENGITHYCLGNGECGGCQQEKNWQTLNQMPDALRKPLQAQAQRIDDTDCILAGRPWRVGA*
C687J26627_1033053C687J26627_10330531F100657VFTPAGWRNETVTATLELISPKRGRVLCVTDIGGNGTSGYGSRTGAKRQRYHVGGVAMREEGKIKNLSACCVL*
C687J26627_1036776C687J26627_10367762F071896INNSNSRIHWIQLNGRPINLMKIAAPASLPYVELENMAYTSDLIQTGDIYVPDKKVFNSLAILNLKHEDIKLHSELKRMLANLEAEELKEEISKLPDGNKELLAELAIDEYSNLKGSVIDTIEDETKVKISLMKEDEKANKENQEKNKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.