Sample 3300002193

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300002193

3300002193: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC3b day 30

Overview

Basic Information
IMG/M Taxon OID	3300002193 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0047180 \| Gp0072814 \| Ga0022221
Sample Name	Compost microbial communities from Sao Paulo Zoo, Brazil - ZC3b day 30
Sequencing Status	Permanent Draft
Sequencing Center	University of Sao Paulo, Virginia Bioinformatics Institute
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	75159997
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Compost Microbial Communities From Sao Paulo Zoo, Brazil
Type	Engineered
Taxonomy	Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Sao Paulo Zoo, Brazil
Coordinates	Lat. (^o)	-23.651072	Long. (^o)	-46.620675	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099151	Metagenome / Metatranscriptome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
metazooDRAFT_1161919	Not Available	686	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
metazooDRAFT_1161919	metazooDRAFT_11619192	F099151	MIMKFREETYKENGRIIKKYFIDDKEVTQDVFFKLTDELYENAKFIQDEHPDEICNCDDCQYLSDLIREIKIASDSEALDILKNKIDFRVQEAYIQGQHVLANELGNSLLKHAVKLEDELENLYENSSSHEYNEDS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.