NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002543

3300002543: Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-6-D



Overview

Basic Information
IMG/M Taxon OID3300002543 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110114 | Gp0061318 | Ga0006569
Sample NameIonic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-6-D
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size131101666
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameIonic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationJoint BioEnergy Institute, California, USA
CoordinatesLat. (o)38.5402Long. (o)-121.75Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001417Metagenome / Metatranscriptome699Y
F001784Metagenome / Metatranscriptome635Y
F003289Metagenome / Metatranscriptome495Y
F056350Metagenome / Metatranscriptome137Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25331J36430_1000448All Organisms → cellular organisms → Bacteria → Proteobacteria25451Open in IMG/M
JGI25331J36430_1001365All Organisms → cellular organisms → Bacteria → Proteobacteria13201Open in IMG/M
JGI25331J36430_1014445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1263Open in IMG/M
JGI25331J36430_1020143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea901Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25331J36430_1000448JGI25331J36430_100044826F001417VQDAVTQMTFSSCDKDDVLELIERVENELHSPHPNLALMCTFLNSIARSLRAQPEAREACLAIEEAIEKAGMPSTWQSGI*
JGI25331J36430_1001365JGI25331J36430_10013656F001784MGDVIHVAFGIEREWERAREHAIDGLVTIGALFGDDEALMRAKAECVYQLLRRIVEDMPPLQITTALPDDLSEGQLALVTDALKSAAXXGIQVAMMHSVEALMNSIYDLCTSKLQQPEL*
JGI25331J36430_1014445JGI25331J36430_10144451F003289MWGNVTIEANLQSNFNIGFTNTKTDILIHLTQ*QY*W*F*FSFLWAFYYLTILKIVRFRTLKFRPRIATTLRPHGK*GDLIICIIPVS*CANIISNSNFILRMIE*QSEASLLTVRIRGKQWY*VYKFELKTFTDVLTVPKNIGRNK*QISTPGDLQVADDYLHILQLRAQNK*VKNY*SDMVKKTSKTKNFHLISPQEQLRYDFF
JGI25331J36430_1020143JGI25331J36430_10201431F056350MPITFFNLIRYFTVLSVSFHDVNSLFGFFILLTVFSQLVSGTMLSFSLIPEPMLVPIVRDEEDLEDLYTDDFFWIHERGVDLLFIFS*MHLFRKLYINAFEYENEIAW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.