NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002730

3300002730: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 day 99



Overview

Basic Information
IMG/M Taxon OID3300002730 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0047180 | Gp0094563 | Ga0045859
Sample NameCompost microbial communities from Sao Paulo Zoo, Brazil - ZC4 day 99
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Sao Paulo, Virginia Bioinformatics Institute
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size269590417
Sequencing Scaffolds6
Novel Protein Genes7
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
Not Available1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCompost Microbial Communities From Sao Paulo Zoo, Brazil
TypeEngineered
TaxonomyEngineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001784Metagenome / Metatranscriptome635Y
F003217Metagenome / Metatranscriptome500Y
F012882Metagenome / Metatranscriptome276Y
F022024Metagenome / Metatranscriptome216Y
F036417Metagenome / Metatranscriptome170Y
F056049Metagenome / Metatranscriptome138Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
zc4day99_1479808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria517Open in IMG/M
zc4day99_1491023Not Available536Open in IMG/M
zc4day99_1522823All Organisms → cellular organisms → Bacteria605Open in IMG/M
zc4day99_1524900All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
zc4day99_1557866All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
zc4day99_1594412All Organisms → cellular organisms → Bacteria1655Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
zc4day99_1479808zc4day99_14798082F056049MATRQHHTQPMIRPLEQHVVHSPVRDDAALGPTEDLDRQPDGVPHVVVGLTALFSVMLAMLIAFMIFAGGTVSRAAAVLLALLAVPVIVTTLQRKAARERDHLHPSR*
zc4day99_1491023zc4day99_14910231F012882ETSFYKAPDAVWVKLVIPTAPKGVGRDEFGPLDSQTSIVVRR*
zc4day99_1522823zc4day99_15228231F003217MSDTPYVVQKVEWFQFRSADGKAFFVMVSSLPNGFFTAVPCDLTMVRADHSLMALAPSQDEALAQLQTTLAGKTRDDLFPNAG*
zc4day99_1524900zc4day99_15249001F001784MGDVIHVAFGIEREWERAREHAIDGLVTIGALFGDDEALMRAKAEYVYQLLRRIVEDMPPLQITTALPDDLSEGQLALVTDALKSAAHKGIQVAMMHSVEALMNSIYDLCTSKLQQPEL*
zc4day99_1557866zc4day99_15578661F001784MGEVIHVAFGTEREWEQTHAKTVDSLVAIGALFGDDETLMRAKADCVYHILRQIVEDVPAVQITTRLPENLTEEQLCLMTNAIKEAALKGIEVAMTHSVQVVMSSIYDLCTSKLQQAYSS
zc4day99_1568311zc4day99_15683111F022024NRGEPEAGYPAAYPFRRIVRAVPIGNDDSISPGTSPAPVGFNLGAPSACVLGATAAPDRYGVRNGSSNSTAILSGLLAAIWSRTPYARLTVDEFLAEVIEKRLHGSPRRSKPGGREPYLDGVPLADACTLADARRSALVCALENQ*
zc4day99_1594412zc4day99_15944122F036417MVYYARVPLRKKIPTVLVRLDTDDGVVTFRARWHRSALELQRAILFRLRQGHPLWFEDEWGHSHCFKPERVWGALVDGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.