NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002738

3300002738: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA



Overview

Basic Information
IMG/M Taxon OID3300002738 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053073 | Gp0061141 | Ga0007021
Sample NameArabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size96859694
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF4441
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameArabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
TypeHost-Associated
TaxonomyHost-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationUniversity of North Carolina, USA
CoordinatesLat. (o)35.9082Long. (o)-79.0499Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024826Metagenome / Metatranscriptome204Y
F040130Metagenome / Metatranscriptome162Y
F040670Metagenome / Metatranscriptome161Y
F060965Metagenome / Metatranscriptome132Y
F099381Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25154J39366_1000741All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales14639Open in IMG/M
JGI25154J39366_1001872All Organisms → cellular organisms → Bacteria → Proteobacteria6404Open in IMG/M
JGI25154J39366_1003757All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF4443015Open in IMG/M
JGI25154J39366_1020243All Organisms → cellular organisms → Bacteria639Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25154J39366_1000741JGI25154J39366_100074116F024826MADATPYFGIAPFVLGMTRELARAAAGKPDSVETTSDDEGAAVETWFYDGGEIELEFDPAPEAKLESITAWSDKTTVNGVAIIGCELGDLQRLAKQADIHDLELTDDFADSGQCWQSEQHGLMFWAAKGKVVNMTIFPRFDDSGEEPQWP
JGI25154J39366_1001872JGI25154J39366_10018721F040670ADIGRPPPADAPMQVLPWAEDSTRSIGAEDAATRYQGDLFLPGWLRIELQPTAEQGPGG*
JGI25154J39366_1001957JGI25154J39366_10019576F099381MSEDFKPGTRPLLRLAGLDAVRAFVSRADEAHVIWTAVMAFMLRLYQEPDGKARRESGPTDSQVVTALRAVLQENFGSEAADYVSWALVRYGCRQKPTMTALHPWEGLLFEWQQRKASTPRIALMLRDAGFERPLTPQALEALDGWITDPVTALGAATDIVEALFGERLVSYNLHDDGSTPSHDVLFGGLVASVMPQAKLALLRQSLVRLDDGAVWRVEYTYEGRERQFDARANGSAMDVDGVMQGVDELMESIGRVERAYRLAPGRYNNGETGTFVVVDSQRFPE
JGI25154J39366_1003757JGI25154J39366_10037572F060965MRYSSINNVKLTLALFMTRFCADXTNYAFALDDFAVAADPLD*
JGI25154J39366_1020243JGI25154J39366_10202432F040130VAIVAGVVLGMVIAAGASPWRELFRKTEPVQPAPIQREPAPDTRV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.