NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002860

3300002860: Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - Graham LP Incubations RNA 1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300002860 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0084162 | Gp0055561 | Ga0004694
Sample NameArctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - Graham LP Incubations RNA 1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size743121
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available5
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameArctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)polar biomepolarpeat soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationBarrow Environmental Observatory site, Alaska, USA
CoordinatesLat. (o)71.2999Long. (o)-156.61Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000817Metagenome / Metatranscriptome879Y
F007695Metagenome / Metatranscriptome346Y
F013836Metagenome / Metatranscriptome268Y
F046210Metagenome / Metatranscriptome151N
F105212Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0004694J43177_10028Not Available684Open in IMG/M
Ga0004694J43177_10031Not Available605Open in IMG/M
Ga0004694J43177_10069Not Available837Open in IMG/M
Ga0004694J43177_10149Not Available791Open in IMG/M
Ga0004694J43177_10239Not Available548Open in IMG/M
Ga0004694J43177_10430All Organisms → cellular organisms → Eukaryota1568Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0004694J43177_10028Ga0004694J43177_100281F105212SHKGSPKNGGSGQKFLTEFEAKSYGSQDLHHRWVGVWANREQSNVA*
Ga0004694J43177_10031Ga0004694J43177_100311F105212VSHKGSPKNGGSGQKFLIELEAKSNGSQDLHHRRVGVQDHKEQSDVIRATKKC*
Ga0004694J43177_10069Ga0004694J43177_100691F000817EQKQPAAFNRLKPEVSRIIPGDWGKAGPGWLAKPLLKRIERFGSGGRIHQFL*
Ga0004694J43177_10149Ga0004694J43177_101492F007695VKRRDPWHGANALSKAAADPVLMVKTRNKNRRRVLTWFASWWRNHRPKQAEKPHSKSSGRKALDGPATRPKTPLAVENGVGKLTAPERGVPNVGMGKRAWRTPIPH
Ga0004694J43177_10239Ga0004694J43177_102391F013836FQVIRFAALPTTGMPGTEHRNRERCTLRLSAPQQPLSPATGSMLPGASQPFFSPHRGRSLVTAFPSPTTTPACAKPIPGSKVLTCYFAPCYLALLPVRPFCSTTVAGSPRLRPLHRFWPVAKSPNSPADGASCLHSPPGLLPPSGSKRSAGFAACQARLPNPPDFLSLPAARFYH*
Ga0004694J43177_10430Ga0004694J43177_104302F046210MKNLKIEAEKGFRRTLFEPELVDPNLEINFVNDAGAALKSCNVNS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.