x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300002932
3300002932: Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010
Overview
| Basic Information |
| IMG/M Taxon OID | 3300002932 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0085494 | Gp0055707 | Ga0052930 |
| Sample Name | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Harvard University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 94594332 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Cephalotes Ants Gut Microbiomes |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Ant Gut → Cephalotes Ants Gut Microbiomes |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information |
| Location | Drexel University, Philadelphia, USA |
| Coordinates | Lat. (o) | -12.5 | Long. (o) | -75.189896 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F054614 | Metagenome / Metatranscriptome | 139 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| CVPL010L_1049596 | CVPL010L_10495962 | F054614 | MSLILTLTGKSNVLATTYFPAIDLSDDDYELGLMNFETYNTISNVNASNNKFYFDENDMEITIPEGSYELH |
