NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002977

3300002977: Biogas reactor microbial communities from Swedish University of Agricultural Sciences, Alnarp, Sweden



Overview

Basic Information
IMG/M Taxon OID3300002977 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111348 | Gp0099493 | Ga0053369
Sample NameBiogas reactor microbial communities from Swedish University of Agricultural Sciences, Alnarp, Sweden
Sequencing StatusPermanent Draft
Sequencing Center
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size134240476
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium ADurb.Bin2391
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBiogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose
TypeEngineered
TaxonomyEngineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Surface (non-saline)

Location Information
LocationSLU, Alnarp, Sweden
CoordinatesLat. (o)55.656904Long. (o)13.082968Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008498Metagenome / Metatranscriptome332Y
F014634Metagenome / Metatranscriptome261Y
F022612Metagenome / Metatranscriptome213Y
F077200Metagenome / Metatranscriptome117N
F103990Metagenome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
soap12_1000504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium ADurb.Bin2391006Open in IMG/M
soap12_1004097All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium1052Open in IMG/M
soap12_1024288Not Available1468Open in IMG/M
soap12_1042940Not Available2619Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
soap12_1000504soap12_10005041F103990GCIGLKSSNILNQKQKDKINEVVRLITIEKRLGKTSITKEDADFVKALSDTKHYPRAEYVLARMYLCGYQIEQDKTMGMKYLARSSRHAGYDLQLKIAYMYHVLGETKTIKECLKSARDDCI*
soap12_1004097soap12_10040972F022612MRKILAYSNQYRRIRKDVARRLFKEGKTIYLTPSNVAANDSNPWIKPYAINNRTERDFDSIVNNYEYYNCCYELGYYTNFWINEEEEEE*
soap12_1004097soap12_10040973F014634MIREKIKEIFDLERIREYAETNIDLTEWIEEEYGETRKILLIATLVEGGYGAYVPGMVLELFGQADDYDLEDPYNLEKNETIYDALMSLETEVNKCLNELLPAKGTYYMGYHEADG
soap12_1024288soap12_10242883F008498MGTVSYKNQPAIDKTKGNVPLAGTSHIYKVKKRLWNDSIEDVLQELFIGRTLHVCCGKSLIGDVRLDIDAEHNPDIVCDASNMKDFVKDNEFETVLCDPPYNGKFQWNHDLLYELQRVASKRIIFQHWFIPANKDGLYKKAQEKFELTELLCWQPKTYFGRVQMVSVFDRR*
soap12_1042940soap12_10429401F077200YNMTPEEALERKRIGENYFPIRDQKIVAAGVINFFSKEEKIGIMAAVFAGEEKKILDNLAKRLDKIVKTTGKPFFVTGDGRKYALEILAGRAMSYMIEAKQKDQEVIPELQDMIKIITSPKNGYLKPFDTRDSIDIQAAFGLGHDIIPLPEKLQYTNEDLPELAENVKGILLDMMKNYACYAEVQGEKMKPVIYKLNEKVFKTTEIFKFEDHDESDIEKTLDKEELEIER*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.