Sample 3300003128

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003128

3300003128: Acid mine drainage microbial communities from Los Rueldos abandoned Hg mine in Spain - Sample B1A

Overview

Basic Information
IMG/M Taxon OID	3300003128 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111449 \| Gp0097857 \| Ga0052265
Sample Name	Acid mine drainage microbial communities from Los Rueldos abandoned Hg mine in Spain - Sample B1A
Sequencing Status	Permanent Draft
Sequencing Center	Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	14354694
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → acid mine drainage → acidic water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Vally of Mogao stream, Los Rueldos site, NW Spain
Coordinates	Lat. (^o)	43.25	Long. (^o)	-5.7666667	Alt. (m)	N/A	Depth (m)	.03 to .5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013397	Metagenome / Metatranscriptome	271	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0052265_110637	All Organisms → cellular organisms → Bacteria → Proteobacteria	1056	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0052265_110637	Ga0052265_1106372	F013397	MTSIAATLGIRERLRQRVLPHHEAWRRQDEYAGGCLCDGCGERSTSARASYEVDFSPDVTPQSVKLHRARVKIWQYEGESPPIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.