Basic Information | |
---|---|
IMG/M Taxon OID | 3300003155 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111493 | Gp0097869 | Ga0052270 |
Sample Name | Broiler Chicken cecum microbial communities from the University of Birmingham, UK |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Birmingham |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 286286924 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11 | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Broiler Chicken Cecum Microbial Communities From The University Of Warwick, United Kingdom |
Type | Host-Associated |
Taxonomy | Host-Associated → Birds → Digestive System → Ceca → Lumen → Broiler Chicken Cecum → Broiler Chicken Cecum Microbial Communities From The University Of Warwick, United Kingdom |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | University of Birmingham, UK | |||||||
Coordinates | Lat. (o) | 50.9047 | Long. (o) | -3.5233 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051936 | Metagenome | 143 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0052270_10308069 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11 | 3072 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0052270_10308069 | Ga0052270_103080694 | F051936 | MKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFATLIIRYLSIHISIKK* |
⦗Top⦘ |