Sample 3300003439

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003439

3300003439: Subsurface hydrocarbon microbial communities from various worldwide Shell locations

Overview

Basic Information
IMG/M Taxon OID	3300003439 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	\| \|
Sample Name	Subsurface hydrocarbon microbial communities from various worldwide Shell locations
Sequencing Status	Complete
Sequencing Center	Shell Corporation
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	2592275199
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Oil Reservoir
Type	Environmental
Taxonomy	Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Reservoir

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Unclassified

Location Information
Location	Red Deer, Alberta, Canada
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024691	Metagenome	204	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
A7A1_132925	A7A1_1329252	F024691	MRYHAEGERDTRNIKTNLPLVEVKASKRKSTKHDRVLIILSTLIKNFSERVNTDHVKPPIHLDRSLKLTDEKGKRYDIAFIYEGDLFLIEVKRCGKWQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.