 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003472 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111451 | Gp0104005 | Ga0059299 |
| Sample Name | Beaver gut microbial communities from British Columbia, Canada - Beaver Fecal Sample 1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Genome Quebec |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 131067612 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Hespellia → Hespellia stercorisuis | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Beaver Gut Microbial Communities From British Columbia, Canada |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Beaver Gut → Beaver Gut Microbial Communities From British Columbia, Canada |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Canada: Langley Township, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.01063 | Long. (o) | -122.625468 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019676 | Metagenome / Metatranscriptome | 228 | Y |
| F059106 | Metagenome | 134 | N |
| F069970 | Metagenome | 123 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| BeaverFeces_1009059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Hespellia → Hespellia stercorisuis | 3865 | Open in IMG/M |
| BeaverFeces_1029222 | Not Available | 1484 | Open in IMG/M |
| BeaverFeces_1056389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 986 | Open in IMG/M |
| BeaverFeces_1076094 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2299 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| BeaverFeces_1009059 | BeaverFeces_10090593 | F059106 | MHVIVWKIRVILLQIFAWIVDLKAREHLTGYLRKDTKYRRVTTGTHM* |
| BeaverFeces_1029222 | BeaverFeces_10292223 | F019676 | MAICSLALASLLVGCDRQVSSEKSSTVGSDGTVKSKEKTVTTSPDGTVTKTEESKKTTPPEKP* |
| BeaverFeces_1056389 | BeaverFeces_10563893 | F059106 | FGKIRVILLQTFVWIVDLKVRETFNRVFKERYKISRVIIGVFV* |
| BeaverFeces_1076094 | BeaverFeces_10760942 | F069970 | MTTQHTAINVGDKVTFDNDKIEIFKAETSSDDMAVRQYQQLVLGGIDQVGVVKELGGNLTTVSYPDGWDLPVPTKYLIVLPSE* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |