Sample 3300003509

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003509

3300003509: Marine hydrothermal diffuse flow vent microbial communities from the Mid-Cayman Rise, Caribbean Sea - Sample FS848

Overview

Basic Information
IMG/M Taxon OID	3300003509 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111537 \| Gp0106822 \| Ga0060303
Sample Name	Marine hydrothermal diffuse flow vent microbial communities from the Mid-Cayman Rise, Caribbean Sea - Sample FS848
Sequencing Status	Permanent Draft
Sequencing Center	Marine Biological Laboratory
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	57973490
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Hydrothermal Diffuse Flow Vent Microbial Communities From The Mid-Cayman Rise, Caribbean Sea
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Marine Hydrothermal Diffuse Flow Vent → Marine Hydrothermal Diffuse Flow Vent Microbial Communities From The Mid-Cayman Rise, Caribbean Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Mid-Cayman Rise
Coordinates	Lat. (^o)	18.376929	Long. (^o)	-81.797906	Alt. (m)	N/A	Depth (m)	2308
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052659	Metagenome / Metatranscriptome	142	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
FS848_1004106	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005	3196	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
FS848_1004106	FS848_10041062	F052659	MLLSGNPGTETRSAVFIDGRLISSIPELNYQTIDKLQQGGVPDKVSWMKPSLRGRLRLVKLQAQERNLTIEDLNQSIRSKWVILWAEV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.